Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
To Order : [email protected]
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
RDR-PLA2G10-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
RDR-PLA2G10-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Human Phospholipase A2, Group X (PLA2G10)ELISA kit |
|||
201-12-2526 | SunredBio | 96 tests | EUR 528 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
20-abx152758 | Abbexa |
|
|
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
abx252990-96tests | Abbexa | 96 tests | EUR 801.6 |
Human PLA2G10(Phospholipase A2, Group X) ELISA Kit |
|||
EH3603 | FN Test | 96T | EUR 628.92 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
SED833Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5677.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
SED833Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 572.76 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
SED833Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 766.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
SED833Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3090.6 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids. |
Human Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
4-SED833Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group X(PLA2G10)ELISA Kit |
|||
QY-E05176 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Phospholipase A2, Group X (PLA2G10)ELISA kit |
|||
YLA3195HU-48T | Shanghai YL Biotech | 48T | EUR 435 |
Human Phospholipase A2, Group X (PLA2G10)ELISA kit |
|||
YLA3195HU-96T | Shanghai YL Biotech | 96T | EUR 562.5 |
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
20-abx126373 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
20-abx128169 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
20-abx301835 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody |
|||
20-abx174048 | Abbexa |
|
|
Recombinant Phospholipase A2, Group X (PLA2G10) |
|||
4-RPD833Hu01 | Cloud-Clone |
|
|
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli |
Human Phospholipase A2, Group X (PLA2G10) Protein |
|||
20-abx167064 | Abbexa |
|
|
Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
abx360270-96tests | Abbexa | 96 tests | EUR 990 |
Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
abx362012-96tests | Abbexa | 96 tests | EUR 990 |
Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
abx362347-96tests | Abbexa | 96 tests | EUR 990 |
Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit |
|||
abx356098-96tests | Abbexa | 96 tests | EUR 990 |
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
|||
abx197460-96tests | Abbexa | 96 tests | EUR 990 |
Human Phospholipase A2, Group X (PLA2G10) CLIA Kit |
|||
20-abx494408 | Abbexa |
|
|
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
|||
E-EL-H1011 | Elabscience Biotech | 1 plate of 96 wells | EUR 640.8 |
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human PLA2G10 (Phospholipase A2, Group X) |
|||
ELK4236 | ELK Biotech | 1 plate of 96 wells | EUR 518.4 |
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Phospholipase A2, Group X (PLA2G10) Antibody (HRP) |
|||
20-abx315919 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody (FITC) |
|||
20-abx315920 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Antibody (Biotin) |
|||
20-abx315921 | Abbexa |
|
|
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human) |
|||
4-PAD833Hu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10) |
CLIA kit for Human PLA2G10 (Phospholipase A2, Group X) |
|||
E-CL-H0681 | Elabscience Biotech | 1 plate of 96 wells | EUR 700.8 |
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC |
|||
4-PAD833Hu01-APC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated |
|||
4-PAD833Hu01-Biotin | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3 |
|||
4-PAD833Hu01-Cy3 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC |
|||
4-PAD833Hu01-FITC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP |
|||
4-PAD833Hu01-HRP | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE |
|||
4-PAD833Hu01-PE | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE. |
Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7 |
|||
4-PAD833Hu01-APC-Cy7 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7. |
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
CSB-EL018085HU-24T | Cusabio | 1 plate of 24 wells | EUR 198 |
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
1-CSB-EL018085HU | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT |
|||
ELI-37033h | Lifescience Market | 96 Tests | EUR 988.8 |
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
CSB-EL018085MO-24T | Cusabio | 1 plate of 24 wells | EUR 198 |
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
1-CSB-EL018085MO | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
CSB-EL018085RA-24T | Cusabio | 1 plate of 24 wells | EUR 198 |
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit |
|||
1-CSB-EL018085RA | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT |
|||
ELI-16162m | Lifescience Market | 96 Tests | EUR 1038 |
PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein |
|||
PROTO15496 | BosterBio | Regular: 10ug | EUR 380.4 |
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
|||
KTE100470-48T | Abbkine | 48T | EUR 398.4 |
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
|||
KTE100470-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2538 |
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10) |
|||
KTE100470-96T | Abbkine | 96T | EUR 646.8 |
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit |
|||
201-12-2525 | SunredBio | 96 tests | EUR 528 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit |
|||
201-12-2527 | SunredBio | 96 tests | EUR 528 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit |
|||
201-12-2529 | SunredBio | 96 tests | EUR 528 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit |
|||
201-12-2530 | SunredBio | 96 tests | EUR 528 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
20-abx152759 | Abbexa |
|
|
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
20-abx152760 | Abbexa |
|
|
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
20-abx152761 | Abbexa |
|
|
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
20-abx152762 | Abbexa |
|
|
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
20-abx152763 | Abbexa |
|
|
Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit |
|||
abx253845-96tests | Abbexa | 96 tests | EUR 801.6 |
Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit |
|||
abx575929-96tests | Abbexa | 96 tests | EUR 886.8 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
DLR-PLA2G12B-Hu-48T | DL Develop | 48T | EUR 664.8 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
DLR-PLA2G12B-Hu-96T | DL Develop | 96T | EUR 870 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
DLR-PLA2G2A-Hu-48T | DL Develop | 48T | EUR 620.4 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
DLR-PLA2G2A-Hu-96T | DL Develop | 96T | EUR 807.6 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
DLR-PLA2G2D-Hu-48T | DL Develop | 48T | EUR 597.6 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
DLR-PLA2G2D-Hu-96T | DL Develop | 96T | EUR 776.4 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
DLR-PLA2G3-Hu-48T | DL Develop | 48T | EUR 620.4 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
DLR-PLA2G3-Hu-96T | DL Develop | 96T | EUR 807.6 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
DLR-PLA2G4D-Hu-48T | DL Develop | 48T | EUR 664.8 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
DLR-PLA2G4D-Hu-96T | DL Develop | 96T | EUR 870 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
DLR-PLA2G5-Hu-48T | DL Develop | 48T | EUR 620.4 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
DLR-PLA2G5-Hu-96T | DL Develop | 96T | EUR 807.6 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids. |
Human Group XVI phospholipase A2, PLA2G16 ELISA KIT |
|||
ELI-45167h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Group XV phospholipase A2, PLA2G15 ELISA KIT |
|||
ELI-21820h | Lifescience Market | 96 Tests | EUR 988.8 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
SED827Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5677.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
SED827Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 572.76 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
SED827Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 766.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
SED827Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3090.6 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
4-SED827Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
SED832Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5677.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
SED832Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 572.76 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
SED832Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 766.8 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
SED832Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3090.6 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group V (PLA2G5) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
4-SED832Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
SEM563Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 6227.58 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
SEM563Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 618.04 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
SEM563Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 831.48 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
SEM563Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3381.66 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in Tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
4-SEM563Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
SEN729Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 6227.58 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
SEN729Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 618.04 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
SEN729Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 831.48 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
SEN729Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3381.66 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
4-SEN729Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from Serum, plasma, tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
RD-PLA2G12B-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 675.6 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
RD-PLA2G12B-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 939.6 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
RD-PLA2G2A-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 625.2 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
RD-PLA2G2A-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 867.6 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
RD-PLA2G2D-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 600 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
RD-PLA2G2D-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 830.4 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
RD-PLA2G3-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 625.2 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
RD-PLA2G3-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 867.6 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
RD-PLA2G4D-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 675.6 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
RD-PLA2G4D-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 939.6 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
RD-PLA2G5-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 625.2 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
RD-PLA2G5-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 867.6 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
RDR-PLA2G12B-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 706.8 |
Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit |
|||
RDR-PLA2G12B-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 984 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
RDR-PLA2G2A-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit |
|||
RDR-PLA2G2A-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
RDR-PLA2G2D-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 626.4 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
RDR-PLA2G2D-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 868.8 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
RDR-PLA2G3-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Phospholipase A2, Group III (PLA2G3) ELISA Kit |
|||
RDR-PLA2G3-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
RDR-PLA2G4D-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 706.8 |
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit |
|||
RDR-PLA2G4D-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 984 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
RDR-PLA2G5-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 652.8 |
Human Phospholipase A2, Group V (PLA2G5) ELISA Kit |
|||
RDR-PLA2G5-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 907.2 |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
SEB077Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5402.92 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
SEB077Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 550.13 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
SEB077Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 734.46 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
SEB077Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2945.08 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group IID (PLA2G2D) in serum, plasma, tissue homogenates and other biological fluids. |
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit |
|||
4-SEB077Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit |
|||
QY-E05175 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit |
|||
QY-E05205 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit |
|||
QY-E05226 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit |
|||
QY-E05227 | Qayee Biotechnology | 96T | EUR 433.2 |
Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A) |
|||
RK02095 | Abclonal | 96 Tests | EUR 625.2 |
Human Phospholipase A2, Group IID ELISA Kit (PLA2G2D) |
|||
RK02096 | Abclonal | 96 Tests | EUR 625.2 |
Human Phospholipase A2, Group V ELISA Kit (PLA2G5) |
|||
RK02097 | Abclonal | 96 Tests | EUR 625.2 |
Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit |
|||
YLA0351HU-48T | Shanghai YL Biotech | 48T | EUR 435 |
Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit |
|||
YLA0351HU-96T | Shanghai YL Biotech | 96T | EUR 562.5 |
Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit |
|||
YLA3194HU-48T | Shanghai YL Biotech | 48T | EUR 435 |
Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit |
|||
YLA3194HU-96T | Shanghai YL Biotech | 96T | EUR 562.5 |
Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit |
|||
YLA3196HU-48T | Shanghai YL Biotech | 48T | EUR 435 |
Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit |
|||
YLA3196HU-96T | Shanghai YL Biotech | 96T | EUR 562.5 |
Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit |
|||
YLA3197HU-48T | Shanghai YL Biotech | 48T | EUR 435 |
Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit |
|||
YLA3197HU-96T | Shanghai YL Biotech | 96T | EUR 562.5 |
Phospholipase A2, Group Ive Antibody |
|||
20-abx114482 | Abbexa |
|
|
Phospholipase A2, Group Ivf Antibody |
|||
20-abx114483 | Abbexa |
|
|
Phospholipase A2, Group Xiia Antibody |
|||
20-abx114484 | Abbexa |
|
|
Phospholipase A2, Group Xiib Antibody |
|||
20-abx114485 | Abbexa |
|
|
Human Phospholipase A2 Group XII A (PLA2G12A) ELISA Kit |
|||
abx382266-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Phospholipase A2 Group IV B (PLA2G4B) ELISA Kit |
|||
abx382267-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Phospholipase A2 Group IV E (PLA2G4E) ELISA Kit |
|||
abx382268-96tests | Abbexa | 96 tests | EUR 1093.2 |
Human Phospholipase A2 Group IV F (PLA2G4E) ELISA Kit |
|||
20-abx382269 | Abbexa |
|
|
Human Phospholipase A2, Group II A (PLA2G2A) ELISA Kit |
|||
abx251779-96tests | Abbexa | 96 tests | EUR 904.8 |